Tested Applications
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-17402 targets CXCL12/SDF-1 in FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11379 Product name: Recombinant human CXCL12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-89 aa of BC039893 Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| GenBank Accession Number | BC039893 |
| Gene Symbol | CXCL12/SDF-1 |
| Gene ID (NCBI) | 6387 |
| RRID | AB_3672674 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48061 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). This antibody can detect all the isoforms of CXCL12/SDF1.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 CXCL12/SDF-1 antibody CL488-17402 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

