• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CHOP/GADD153 Polyclonal antibody

CHOP/GADD153 Polyclonal Antibody for IF/ICC
Cat No. CL488-15204

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

CHOP; GADD153, CHOP, DDIT3, GADD153, C/EBP zeta

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTunicamycin treated HeLa cells

Samples need to be treated with ER stress.

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15204 targets CHOP/GADD153 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7354

Product name: Recombinant human CHOP; GADD153 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-169 aa of BC003637

Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Predict reactive species
Full Name DNA-damage-inducible transcript 3
Calculated Molecular Weight 19 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC003637
Gene Symbol CHOP
Gene ID (NCBI) 1649
RRIDAB_3672624
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35638
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CHOP/GADD153 antibody CL488-15204Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...