CoraLite® Plus 488-conjugated CCS Polyclonal antibody

CCS Polyclonal Antibody for IF/ICC
Cat No. CL488-22802

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Superoxide Dismutase 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22802 targets CCS in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18850

Product name: Recombinant human CCS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-274 aa of BC105016

Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

Predict reactive species
Full Name copper chaperone for superoxide dismutase
Calculated Molecular Weight 274 aa, 29 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC105016
Gene Symbol CCS
Gene ID (NCBI) 9973
RRIDAB_3672750
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14618
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Copper chaperone for superoxide dismutase (CCS) is a soluble factor that converts copper into copper-zinc superoxide dismutase ( SOD1 ). CCS and SOD1 interact directly in vivo and in vitro, and this interaction is mediated by homologous domains in each protein. CCS not only interacts with wild-type SOD1 but also interacts with SOD1 containing common missense mutations, resulting in FALS.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CCS antibody CL488-22802Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...