CoraLite®594-conjugated C9orf72 Monoclonal antibody

C9orf72 Monoclonal Antibody for IF/ICC
Cat No. CL594-66140
Clone No.3D2H6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC

C9orf72, RP11 27J8.2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66140 targets C9orf72 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21080

Product name: Recombinant human C9orf72 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-169 aa of BC020851

Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

Predict reactive species
Full Name chromosome 9 open reading frame 72
Calculated Molecular Weight 481 aa, 54 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC020851
Gene Symbol C9orf72
Gene ID (NCBI) 203228
RRIDAB_2883523
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96LT7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). FTLD-TDP has five subtypes: Sporadic FTLD, GRN mutation FTLD, TARDBP mutation FTLD, VCP mutation FTLD and C9ORF72 mutation FTLD. The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa.

Protocols

Product Specific Protocols
IF protocol for CL594 C9orf72 antibody CL594-66140Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...