Use Able AI chat for product recommendations

C9orf72 Monoclonal antibody

C9orf72 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66140-1-Ig
Clone No. 3D2H6
Publications (6)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

3D2H6, C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for C9orf72 in ?

Tested Applications

Positive WB detected inhuman brain tissue, C6 cells, Neuro-2a cells
Positive IP detected inC6 cells
Positive IHC detected inhuman gliomas tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66140-1-Ig targets C9orf72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21080

Product name: Recombinant human C9orf72 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-169 aa of BC020851

Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

Predict reactive species
Full Name chromosome 9 open reading frame 72
Calculated Molecular Weight 481 aa, 54 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC020851
Gene Symbol C9orf72
Gene ID (NCBI) 203228
RRIDAB_2784547
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96LT7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). FTLD-TDP has five subtypes: Sporadic FTLD, GRN mutation FTLD, TARDBP mutation FTLD, VCP mutation FTLD and C9ORF72 mutation FTLD. The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa.

Protocols

Product Specific Protocols
IF protocol for C9orf72 antibody 66140-1-IgDownload protocol
IHC protocol for C9orf72 antibody 66140-1-IgDownload protocol
IP protocol for C9orf72 antibody 66140-1-IgDownload protocol
WB protocol for C9orf72 antibody 66140-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The C9ORF72 antibody (Cat# 66140-1-Ig) has 6 total citations published in Nature Neuroscience, Acta Neuropathologica, Acta Neuropathologica Communications, Scientific Reports, Animal Models and Experimental Medicine, and Amyotrophic Lateral Sclerosis and Frontotemporal Degeneration. Research fields include amyotrophic lateral sclerosis (ALS), frontotemporal lobar degeneration, C9orf72 hexanucleotide repeat expansion, actin dynamics in motor neurons, and neurodegeneration. Applications span WB, IHC, and IF in human, mouse, and rat samples.

SpeciesApplicationTitle
humanWB

Nat Neurosci

C9ORF72 interaction with cofilin modulates actin dynamics in motor neurons.

Authors - Rajeeve Sivadasan
humanIHC

Acta Neuropathol

Sense-encoded poly-GR dipeptide repeat proteins correlate to neurodegeneration and uniquely co-localize with TDP-43 in dendrites of repeat-expanded C9orf72 amyotrophic lateral sclerosis.

Authors - Shahram Saberi
mouse,humanWB,IF

Acta Neuropathol Commun

Novel antibodies reveal presynaptic localization of C9orf72 protein and reduced protein levels in C9orf72 mutation carriers.

Authors - Petra Frick
humanWB

Sci Rep

Dual-gRNA approach with limited off-target effect corrects C9ORF72 repeat expansion in vivo.

Authors - Xuejiao Piao
ratWB

Animal Model Exp Med

Knock in of a hexanucleotide repeat expansion in the C9orf72 gene induces ALS in rats.

Authors - Wei Dong
humanIHC

Amyotroph Lateral Scler Frontotemporal Degener

Immunohistochemical detection of C9orf72 protein in frontotemporal lobar degeneration and motor neurone disease: patterns of immunostaining and an evaluation of commercial antibodies.

Authors - Yvonne S Davidson
Loading...
||
New chat

Able™

正在加载,请稍候...