CoraLite® Plus 488-conjugated C9orf72 Polyclonal antibody

• 

  IF Staining of mouse testis using CL488-22637

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using CoraLite® Plus 488 C9orf72 antibody (CL488-22637) at dilution of 1:200.

• Featured Product
• KD/KO Validated

C9orf72 Polyclonal Antibody for IF-P

Cat No. CL488-22637

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

---

Tested Applications

• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22637 targets C9orf72 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18326

  Product name: Recombinant human C9orf72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC020851

  Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

• Full Name: chromosome 9 open reading frame 72
• Calculated Molecular Weight: 481 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa, 25-30 kDa, 43 kDa, 68-72 kDa
• GenBank Accession Number: BC020851
• Gene Symbol: C9orf72
• Gene ID (NCBI): 203228
• RRID: AB_2934416
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LT7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745)