C9orf72 Polyclonal antibody

• 

  WB analysis of rat brain using 22637-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 22637-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22637-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22637-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of transfected cells using 22637-1-AP

  WB result of anti-C9ORF72 (22637-1-AP) with Variant1 and 2 transfected. (by Dr. Sarah Mueller).

• 

  WB analysis of SH-SY5Y using 22637-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Sp2/0 using 22637-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 22637-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 22637-1-AP

  IP result of anti-C9orf72 (IP:22637-1-AP, 3ug; Detection:22637-1-AP 1:300) with SH-SY5Y cells lysate 2000ug.

• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human gliomas using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 22637-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of SH-SY5Y using 22637-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using C9orf72 antibody (22637-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

C9orf72 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22637-1-AP

Publications(36)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

---

Tested Applications

• Positive WB detected in: C2C12 cells, HeLa cells, mouse testis tissue, rat brain tissue, SH-SY5Y cells, Sp2/0 cells, transfected cells, HEK-293 cells, NIH/3T3 cells
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: human gliomas tissue, human testis tissue, mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 17 publications below
• WB: See 34 publications below
• IHC: See 2 publications below
• IF: See 9 publications below
• CoIP: See 2 publications below

Product Information

22637-1-AP targets C9orf72 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, caenorhabditis elegans
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18326

  Product name: Recombinant human C9orf72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC020851

  Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

• Full Name: chromosome 9 open reading frame 72
• Calculated Molecular Weight: 481 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC020851
• Gene Symbol: C9orf72
• Gene ID (NCBI): 203228
• RRID: AB_10953528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Science; C9orf72 is required for proper macrophage and microglial function in mice.; Authors - J G O'Rourke ; KO Validated
human	wb	Nat Med; Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons.; Authors - Yingxiao Shi
mouse,human	WB,CoIP	Cell Metab; C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.; Authors - Tao Wang ; KO Validated
mouse,human	WB	Nat Neurosci; Reduced C9ORF72 function exacerbates gain of toxicity from ALS/FTD-causing repeat expansion in C9orf72.; Authors - Qiang Zhu ; KO Validated
human	WB	Nat Commun; C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy; Authors - Shen Zhang ; KO Validated
mouse	WB	Sci Transl Med; Loss-of-function mutations in the C9ORF72 mouse ortholog cause fatal autoimmune disease.; Authors - Aaron Burberry ; KO Validated