CoraLite® Plus 750-conjugated Beta Tubulin Recombinant monoclonal antibody

• 

  WB analysis using CL750-80713

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-80713 (Beta Tubulin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using CL750-80713

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-80713 (Beta Tubulin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

Beta Tubulin Recombinant Antibody for WB

Cat No. CL750-80713

Clone No.2O13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

WB

Synonyms

Tubulin beta III, Tubulin beta 3 chain, Tubulin beta-4 chain, Tubulin beta-3 chain, TUBB4

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-80713 targets Beta Tubulin in WB applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0117

  Product name: Recombinant human Tubulin-beta protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-259 aa of BC000748

  Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

• Full Name: tubulin, beta 3
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000748
• Gene Symbol: TUBB3
• Gene ID (NCBI): 10381
• RRID: AB_3086573
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13509
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.