CoraLite® Plus 488-conjugated BRAF Polyclonal antibody

BRAF Polyclonal Antibody for IF/ICC
Cat No. CL488-20899

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

B RAF1, BRAF, BRAF1, FLJ95109, p94, Proto oncogene B Raf, RAFB1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20899 targets BRAF in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15014

Product name: Recombinant human BRAF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 500-766 aa of BC101757

Sequence: NEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH

Predict reactive species
Full Name v-raf murine sarcoma viral oncogene homolog B1
Calculated Molecular Weight 766 aa, 84 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC101757
Gene Symbol BRAF
Gene ID (NCBI) 673
RRIDAB_3084045
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15056
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

B-Raf proto-oncogene serine/threonine kinase(BRAF), is a protein belonging to the raf/mil family of serine/threonine protein kinases. BRAF plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. BRAF is associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. BRAF is also associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. BRAF plays a role in the PD-1/PDL-1 pathway. In some cancers, BRAF is activated by rearrangements that fuse its kinase domain to 5' partner genes and then has different molecular weights (PMID: 23890088). BRAF has several isoforms, the calculated molecular weight of BRAF is 84 kDa, but the observed molecular weight is about 65 kDa(isoform).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 BRAF antibody CL488-20899Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...