AIRE Monoclonal antibody

• 

  WB analysis of human spleen using 66262-1-Ig

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig spleen using 66262-1-Ig

  pig spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 66262-1-Ig

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 66262-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AIRE antibody (66262-1-Ig, Clone: 1A3C3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

AIRE Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66262-1-Ig

Clone No.1A3C3

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, ELISA

Synonyms

PGA1, APSI, APS1, APECED, AIRE1

---

Tested Applications

• Positive WB detected in: human spleen tissue, pig spleen tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66262-1-Ig targets AIRE in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19103

  Product name: Recombinant human AIRE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-348 aa of BC137270

  Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

• Full Name: autoimmune regulator
• Calculated Molecular Weight: 545 aa, 58 kDa
• Observed Molecular Weight: 58-69 kDa
• GenBank Accession Number: BC137270
• Gene Symbol: AIRE
• Gene ID (NCBI): 326
• RRID: AB_2881649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Fla (Verified Customer) (02-05-2026)

The antybody works beautifully on human frozen thymus

• Applications: Immunohistochemistry, Immunofluorescence
• Cell Tissue Type: human thymus