AIRE Monoclonal antibody, PBS Only

• 

  WB analysis of human spleen using 66262-1-Ig (same clone as 66262-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66262-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig spleen using 66262-1-Ig (same clone as 66262-1-PBS)

  pig spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66262-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 66262-1-Ig (same clone as 66262-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66262-1-Ig (AIRE Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66262-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66262-1-Ig (same clone as 66262-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AIRE antibody (66262-1-Ig, Clone: 1A3C3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66262-1-PBS in a different storage buffer formulation.

AIRE Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66262-1-PBS

Clone No.1A3C3

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PGA1, APSI, APS1, APECED, AIRE1

---

Product Information

66262-1-PBS targets AIRE in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19103

  Product name: Recombinant human AIRE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-348 aa of BC137270

  Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

• Full Name: autoimmune regulator
• Calculated Molecular Weight: 545 aa, 58 kDa
• Observed Molecular Weight: 58-69 kDa
• GenBank Accession Number: BC137270
• Gene Symbol: AIRE
• Gene ID (NCBI): 326
• RRID: AB_2881649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43918
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.