CoraLite® Plus 647-conjugated 14-3-3 Polyclonal antibody

• 

  FC experiment of HeLa using CL647-14503

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human 14-3-3 (CL647-14503) (red), or 0.2 ug isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

14-3-3 Polyclonal Antibody for FC (Intra)

Cat No. CL647-14503

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

YWHAQ, 14-3-3 protein T-cell, 14-3-3 theta, 14-3-3 zeta, 14-3-3σ

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-14503 targets 14-3-3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5959

  Product name: Recombinant human 14-3-3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-245 aa of BC056867

  Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC056867
• Gene Symbol: 14-3-3 theta
• Gene ID (NCBI): 10971
• RRID: AB_2934897
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27348
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

14-3-3 proteins are the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.