CoraLite® Plus 488-conjugated 14-3-3 Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-66061

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CL488-66061 (14-3-3 antibody) at dilution of 1:50.

14-3-3 Monoclonal Antibody for IF/ICC

Cat No. CL488-66061

Clone No.2E10A3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, mouse, pig

Applications

IF/ICC

Synonyms

14 3 3, 14 3 3 protein T cell, 14 3 3 protein tau, 14 3 3 protein theta, 1C5, HS1, Protein HS1, YWHAQ

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

CL488-66061 targets 14-3-3 in IF/ICC applications and shows reactivity with human, rat, mouse, pig samples.

• Tested Reactivity: human, rat, mouse, pig
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6055

  Product name: Recombinant human 14-3-3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-245 aa of BC056867

  Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 31 kDa, 28 kDa
• GenBank Accession Number: BC056867
• Gene Symbol: 14-3-3 theta
• Gene ID (NCBI): 10971
• RRID: AB_2883245
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P27348
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

14-3-3 proteins interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	Front Pharmacol; Aspirin in combination with gastrodin protects cardiac function and mitigates gastric mucosal injury in response to myocardial ischemia/reperfusion; Authors - Zhiwu Dong