Tested Applications
| Positive IF-P detected in | mouse heart tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-22018 targets N-cadherin in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag16792 Product name: Recombinant human N-cadherin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 421-535 aa of BC036470 Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT Predict reactive species | 
                                    
| Full Name | cadherin 2, type 1, N-cadherin (neuronal) | 
| Calculated Molecular Weight | 906 aa, 100 kDa | 
| Observed Molecular Weight | 130 kDa | 
| GenBank Accession Number | BC036470 | 
| Gene Symbol | N-cadherin | 
| Gene ID (NCBI) | 1000 | 
| RRID | AB_2919867 | 
| Conjugate | CoraLite®594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P19022 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Neuronal cadherin (N-cadherin), also known as cadherin-2 (CDH2), is a calcium-binding protein that mediates cell-cell adhesions of neuronal and some non-neuronal cell types.
What is the molecular weight of N-cadherin? Is N-cadherin post-translationally modified?
The molecular weight of mature N-cadherin is 127 kDa. N-cadherin is synthesized in a precursor form that undergoes proteolytic cleavage by furin at the Golgi apparatus. Additionally, it can be phosphorylated by casein kinase II and N-glycosylated, which affects its stability (PMID: 12604612 and 19846557).
What is the subcellular localization of N-cadherin? What is the tissue expression pattern of N-cadherin?
N-cadherin is an integral membrane protein present at the plasma membrane, forming adherens junctions. It is widely expressed in the nervous system, where it flanks the active zone of synapses and is important for synapse formation and remodeling. It is also present in the lens, skeletal, and cardiac muscles (PMID: 3857614). In the muscle, N-cadherin plays a role in myoblast differentiation, while in the heart it is required for the formation of intercalated discs. Additionally, N-cadherin is present in blood vessels, promoting angiogenesis by forming adhesive complexes between endothelial cells and pericytes (PMID: 24521477).
What is the role of N-cadherin during the epithelial-mesenchymal transition (EMT)?
EMT is a crucial process during gastrulation that leads to the formation of mesenchymal cells. It is marked by decreased expression of E-cadherin and upregulation of N-cadherin, which promotes cell migration (PMID: 23481201). Similarly, upregulation of N-cadherin is observed in many cancer cell types and is associated with increased invasiveness and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 N-cadherin antibody CL594-22018 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







