GAT1 Recombinant monoclonal antibody, PBS Only (Capture)

GAT1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85060-2-PBS
Clone No.242637D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

SLC6A1, 242637D11, GABA Transporter 1, GABATHG, GABATR

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85060-2-PBS targets GAT1 as part of a matched antibody pair:

MP01787-2: 85060-2-PBS capture and 85060-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29712

Product name: Recombinant human SLC6A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-52 aa of BC033904

Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD

Predict reactive species
Full Name solute carrier family 6 (neurotransmitter transporter, GABA), member 1
Calculated Molecular Weight 67 kDa
Observed Molecular Weight67 kDa
GenBank Accession NumberBC033904
Gene Symbol GABA Transporter 1/GAT1
Gene ID (NCBI) 6529
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30531
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...