Filter: AllWBSandwich ELISASample testIHCIF-PCytometric bead arrayAffinity

WB analysis using 85060-2-RR (same clone as 85060-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 85060-2-RR (SLC6A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
Sandwich ELISA standard curve of MP01787-2
Sandwich ELISA standard curve of MP01787-2, Human GAT1 Recombinant Matched Antibody Pair - PBS only. 85060-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag29712. 85060-1-PBS was HRP conjugated as the detection antibody. Range: 0.195-12.5 ng/mL.
Sample test of MP01787-2
The mean GAT1 concentration was determined to be 12.15 ng/mL in SH-SY5Y cell extract based on a 1.40 mg/mL extract load and 1,095.09 ng/mL in mouse cerebellum tissue extract based on a 6.00 mg/mL extract load.
IHC staining of mouse cerebellum using 85060-2-RR (same clone as 85060-2-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 85060-2-RR (GAT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 85060-2-RR (same clone as 85060-2-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 85060-2-RR (GAT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
IHC staining of rat brain using 85060-2-RR (same clone as 85060-2-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 85060-2-RR (GAT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
IF Staining of rat brain using 85060-2-RR (same clone as 85060-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using GAT1 antibody (85060-2-RR, Clone: 242637D11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using GAT1 antibody (85060-2-RR, Clone: 242637D11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85060-2-PBS in a different storage buffer formulation.
Cytometric bead array standard curve of MP01787-2
Cytometric bead array standard curve of MP01787-2, GAT1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85060-2-PBS. Detection antibody: 85060-1-PBS. Standard: Ag29712. Range: 0.625-80 ng/mL.
Affinity and Kinetic Characterization of 85060-2-RR
Biolayer interferometry (BLl) kinetic assays of 85060-2-RR against Human GAT1 were performed. The affinity constant is below 1 pM.

GAT1 Recombinant monoclonal antibody, PBS Only (Capture)

GAT1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85060-2-PBS

Clone No.242637D11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

SLC6A1, 242637D11, GABA Transporter 1, GABATHG, GABATR

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

85060-2-PBS targets GAT1 as part of a matched antibody pair:

MP01787-2: 85060-2-PBS capture and 85060-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag29712 Product name: Recombinant human SLC6A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC033904 Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD Predict reactive species
Full Name	solute carrier family 6 (neurotransmitter transporter, GABA), member 1
Calculated Molecular Weight	67 kDa
Observed Molecular Weight	67 kDa
GenBank Accession Number	BC033904
Gene Symbol	GABA Transporter 1/GAT1
Gene ID (NCBI)	6529
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P30531
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.