ATP1B1 Recombinant monoclonal antibody

ATP1B1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84707-5-RR
Clone No.242109D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242109D12, ATP1B 1, Beta 1 subunit of Na(+) K(+) ATPase, Na, K-ATPase β1, Na+/K+ ATPase beta 1 subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse heart tissue, rat heart tissue, fetal human brain tissue
Positive IHC detected inmouse kidney tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84707-5-RR targets ATP1B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7279

Product name: Recombinant human ATP1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-303 aa of BC000006

Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 1 polypeptide
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 45-52 kDa
GenBank Accession NumberBC000006
Gene Symbol ATP1B1
Gene ID (NCBI) 481
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP05026
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)

Protocols

Product Specific Protocols
IHC protocol for ATP1B1 antibody 84707-5-RRDownload protocol
WB protocol for ATP1B1 antibody 84707-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...