MAP2 Recombinant monoclonal antibody, PBS Only (Detector)

MAP2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IF-Fro, Sandwich ELISA, Indirect ELISA

Cat No. 84306-3-PBS
Clone No.241653E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, Sandwich ELISA, Indirect ELISA

241653E9, MAP 2, MAP-2, MAP2A, MAP2B

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84306-3-PBS targets MAP2 as part of a matched antibody pair:

MP01208-3: 84306-5-PBS capture and 84306-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11580

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
Observed Molecular Weight280-300 kDa, 70-85 kDa
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11137
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in the brain and has an important role in neuronal morphogenesis. Multiple high MW and low MW MAP2 isoforms are expressed within the proximal segment of axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally-specific manner. The 280 kDa MAP2B is present throughout rat brain development, and the slightly larger MAP2A appears first during the end of the second week of postnatal life. MAP2C, composed of several bands of about 70 kDa, is present during early brain development and largely disappears from the mature brain except for the retina, olfactory bulb, and cerebellum. In addition, some isoforms with lower MW around 50-60 kDa also exist. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.

Loading...