Cyclin E1 Recombinant monoclonal antibody

Cyclin E1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82700-10-RR
Clone No.240136D4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

CCNE1, G1/S-specific cyclin-E1, G1/S specific cyclin E1, Cyclin E, CCNE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, MCF-7 cells, rat heart tissue, HuH-7 cells
Positive FC (Intra) detected inHeLa cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82700-10-RR targets Cyclin E1 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2110

Product name: Recombinant human Cyclin E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 111-410 aa of BC035498

Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Predict reactive species
Full Name cyclin E1
Calculated Molecular Weight 410 aa, 47 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC035498
Gene Symbol Cyclin E1
Gene ID (NCBI) 898
RRIDAB_3670531
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP24864
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).

Protocols

Product Specific Protocols
WB protocol for Cyclin E1 antibody 82700-10-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...