Tested Applications
| Positive WB detected in | human plasma tissue, human plasma, rat serum, HuH-7 cells, HepG2 cells, MG-63 cells, U2OS cells | 
| Positive IP detected in | human plasma tissue | 
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | human colon cancer tissue | 
| Positive IF/ICC detected in | NIH/3T3 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 | 
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below | 
| WB | See 97 publications below | 
| IHC | See 44 publications below | 
| IF | See 44 publications below | 
| IP | See 1 publications below | 
| CoIP | See 2 publications below | 
Product Information
66042-1-Ig targets Fibronectin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, canine, sheep | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8016 Product name: Recombinant human FN1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species | 
                                    
| Full Name | fibronectin 1 | 
| Calculated Molecular Weight | 2386 aa, 263 kDa | 
| Observed Molecular Weight | 263 kDa | 
| GenBank Accession Number | BC005858 | 
| Gene Symbol | Fibronectin | 
| Gene ID (NCBI) | 2335 | 
| RRID | AB_11182385 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P02751 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Fibronectin 1 (FN1) is a high molecular weight glycoprotein which exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1). Plasma FN1 (dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. FN1 binds to cell surfaces through integrins and to various compounds including collagen, fibrin and heparin. It is involved in cell adhesion and migration processes including embryogenesis, wound healing, hemostasis, host defense, and metastasis. (PMID: 7276612; 12244123; 12847088)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Fibronectin antibody 66042-1-Ig | Download protocol | 
| IHC protocol for Fibronectin antibody 66042-1-Ig | Download protocol | 
| IP protocol for Fibronectin antibody 66042-1-Ig | Download protocol | 
| WB protocol for Fibronectin antibody 66042-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Protein Cell Neutrophil extracellular traps license macrophage production of chemokines to facilitate CD8+ T cell infiltration in obstruction-induced renal fibrosis | ||
Dev Cell Vimentin intermediate filaments coordinate actin stress fibers and podosomes to determine the extracellular matrix degradation by macrophages | ||
Int J Biol Macromol A multifunctional polydopamine/genipin/alendronate nanoparticle licences fibrin hydrogels osteoinductive and immunomodulatory potencies for repairing bone defects | ||
Biomed Pharmacother Nintedanib prevents TGF-β2-induced epithelial-mesenchymal transition in retinal pigment epithelial cells | ||
Oxid Med Cell Longev HBO1 as an Important Target for the Treatment of CCL4-Induced Liver Fibrosis and Aged-Related Liver Aging and Fibrosis | ||
Front Immunol Integrated analysis reveals crosstalk between pyroptosis and immune regulation in renal fibrosis | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (04-19-2023)  | Worked well for IP, band seen just below 250 kD (page ruler plus ladder). Lower band is light chain IgG 
 ![]()  | 
FH Ren Jie (Verified Customer) (07-11-2022)  | Quite significant smear and non-specific binding 
 ![]()  | 
FH Deqiang (Verified Customer) (05-14-2020)  | it works well on mouse embryo paraffin sections. 
  | 
FH Jihyun (Verified Customer) (05-07-2020)  | There is no background signal. I can get a good one band in the WB. Great! 
  | 

































