Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse kidney tissue, A549 cells |
| Positive IP detected in | HeLa cells, HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human colon tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10853-1-AP targets Palladin in WB, IHC, IF/ICC, FC (Intra), IP, COIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1288 Product name: Recombinant human PALLD,palladin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 127-510 aa of BC013867 Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL Predict reactive species |
| Full Name | palladin, cytoskeletal associated protein |
| Calculated Molecular Weight | 1383 aa, 151 kDa |
| Observed Molecular Weight | 95 kDa, 140 kDa |
| GenBank Accession Number | BC013867 |
| Gene Symbol | palladin |
| Gene ID (NCBI) | 23022 |
| RRID | AB_2158782 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WX93 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Palladin is an actin associated protein serving as a cytoskeleton scaffold, and actin cross linker, localizing at stress fibers, focal adhesions, and other actin based structures. Palladin exists as multiple isoforms through alternative transcription initiation sites and splicing. There are three major isoforms (200, 140, 90-92 kDa) and multiple minor isoforms. Different palladin isoforms are expressed in a tissue-specific pattern during development and in adult organs: the 200 kDa isoform is predominantly expressed in the heart, skeletal muscle, testis and bone; the 140 kDa isoform is widely expressed with the exception of liver, muscle, and skin; the 90-92 kDa isoform is broadly expressed in embryonic tissues and highly expressed in adult smooth muscle tissues (21455759). Recently overexpression of palladin has been linked to the promoted invasive motility in several types of cancers (18978809, 22291919). The 85-90 kDa palladin isoform has been observed predominantly expressed in pancreatic ductal adenocarcinoma (PDA) while a 65 kDa isoform is expressed in normal pancreas and non-PDA tumors (20436683). This antibody, generated against the fragment 999-1383aa of palladin, recognizes most isoforms of this protein, except isoform 6.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Palladin antibody 10853-1-AP | Download protocol |
| IF protocol for Palladin antibody 10853-1-AP | Download protocol |
| IHC protocol for Palladin antibody 10853-1-AP | Download protocol |
| IP protocol for Palladin antibody 10853-1-AP | Download protocol |
| WB protocol for Palladin antibody 10853-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Palladin (Cat# 10853-1-AP) has accumulated 80 citations published in journals including Nature Communications, Molecular Cell, Oncogene, Cancer Research, FASEB Journal, Endocrinology, Journal of Neuroscience, eLife, PLoS ONE, Scientific Reports, and Journal of the American Society of Nephrology. Associated research fields encompass oncology (breast, pancreatic, colorectal, prostate cancers), cytoskeletal and actin biology, reproductive biology (Sertoli cells, spermatogenesis), neuroscience, nephrology, cardiology, and immune phagocytosis.
| Species | Application | Title |
|---|---|---|
Cancer Res Cofilin Drives Cell Invasive and Metastatic Responses to TGF-β in Prostate Cancer. | ||
Nat Commun Local microRNA delivery targets Palladin and prevents metastatic breast cancer.
| ||
Mol Cell The actin-bundling protein palladin is an Akt1-specific substrate that regulates breast cancer cell migration. | ||
Adv Sci (Weinh) ASO Therapy Targeting STAU2 to Inhibit Pancreatic Ductal Adenocarcinoma Progression and Metastasis by Regulating the PALLD-Mediated EMT Signaling Pathway. | ||
Cell Death Differ lncRNA THAP7-AS1, transcriptionally activated by SP1 and post-transcriptionally stabilized by METTL3-mediated m6A modification, exerts oncogenic properties by improving CUL4B entry into the nucleus. |





































