Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, pig heart tissue, human heart tissue, K-562 cells, HSC-T6 cells, RAW 264.7 cells, MCF-7 cells |
| Positive IHC detected in | human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 87 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
66234-1-Ig targets p38 MAPK in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5797 Product name: Recombinant human p38 MAPK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-307 aa of BC031574 Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY Predict reactive species |
| Full Name | mitogen-activated protein kinase 14 |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC031574 |
| Gene Symbol | p38 MAPK |
| Gene ID (NCBI) | 1432 |
| RRID | AB_2861335 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| IHC protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| WB protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hazard Mater ERK/p38/ROS burst responses to environmentally relevant concentrations of diphenyl phosphate-evoked neutrophil extracellular traps formation: Assessing the role of autophagy. | ||
Free Radic Biol Med Cathelicidin-WA attenuates LPS-induced inflammation and redox imbalance through activation of AMPK signaling. | ||
J Invest Dermatol GRP78 Downregulation in Keratinocytes Promotes Skin Inflammation Via the Recruitment and Activation of CCR6+ IL-17A-producing γδ T Cells | ||
Pharmacol Res Anti-thrombotic effects mediated by dihydromyricetin involve both platelet inhibition and endothelial protection. | ||
Pharmacol Res CX-5461 is a potent immunosuppressant which inhibits T cell-mediated alloimmunity via p53-DUSP5. | ||
Development FOXO1 mediates hypoxia-induced G0/G1 arrest in ovarian somatic granulosa cells by activating the TP53INP1-p53-CDKN1A pathway. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Karen (Verified Customer) (11-10-2022) | p38MAPK detection for WB is not good, no bands detectable with different dilutions (1:500 and 1:1000). The same membrane was incubated with another p38MAPK antibody and was nicely visible.
|























