ZC3HAV1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66413-1-Ig (same clone as 66413-1-PBS)

  WB result of ZC3HAV1 antibody (66413-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZC3HAV1 transfected HEK-293 cells. This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66413-1-Ig (same clone as 66413-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66413-1-Ig (ZC3HAV1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66413-1-Ig (same clone as 66413-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66413-1-Ig (ZC3HAV1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66413-1-Ig (same clone as 66413-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66413-1-Ig (ZC3HAV1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66413-1-Ig (same clone as 66413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66413-1-Ig (ZC3HAV1 Antibody) at dilution of 1:300 (under 40x lens). This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66413-1-Ig (same clone as 66413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66413-1-Ig (ZC3HAV1 Antibody) at dilution of 1:300 (under 10x lens). This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66413-1-Ig (same clone as 66413-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ZC3HAV1 antibody (66413-1-Ig, Clone: 1G10B9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 66413-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZC3HAV1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66413-1-PBS

Clone No.1G10B9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PRO1677, PARP13, Inactive Poly [ADP-ribose] polymerase 13, ARTD13, ADP-ribosyltransferase diphtheria toxin-like 13

---

Product Information

66413-1-PBS targets ZC3HAV1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10364

  Product name: Recombinant human ZC3HAV1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC025308

  Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS

• Full Name: zinc finger CCCH-type, antiviral 1
• Calculated Molecular Weight: 699aa,78 kDa; 902aa,101 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC025308
• Gene Symbol: ZC3HAV1
• Gene ID (NCBI): 56829
• RRID: AB_2881785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7Z2W4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

he zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms.