WTAP Monoclonal antibody

• 

  WB analysis using 60188-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60188-1-Ig (WTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 60188-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60188-1-Ig (WTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IP experiment of HeLa using 60188-1-Ig

  IP result of anti-WTAP (IP:60188-1-Ig, 4ug; Detection:10200-1-AP 1:8000) with HeLa cells lysate 2000 ug.

• 

  IHC staining of human colon using 60188-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60188-1-Ig (WTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 60188-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60188-1-Ig (WTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 60188-1-Ig

  Immunofluorescent analysis of (4% PFA ) fixed HeLa cells using 60188-1-Ig(WTAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

WTAP Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60188-1-Ig

Clone No.4A10G9

Publications(107)

Reviews (2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

4A10G9, Female-lethal(2)D homolog (hFL(2)D ), FL2D, KIAA0105, Mum2

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 10 publications below
• WB: See 85 publications below
• IHC: See 19 publications below
• IF: See 12 publications below
• IP: See 4 publications below
• RIP: See 3 publications below

Product Information

60188-1-Ig targets WTAP in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, drosophila
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0259

  Product name: Recombinant human WTAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-150 aa of BC000383

  Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD

• Full Name: Wilms tumor 1 associated protein
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000383
• Gene Symbol: WTAP
• Gene ID (NCBI): 9589
• RRID: AB_10859484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15007
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 45-50 kDa due to phosphorylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Science; Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation.; Authors - Shay Geula
human	WB	Nat Cell Biol; Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes; Authors - Dario F De Jesus
human	WB	Cell Res; Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells.; Authors - Fei Peng
mouse	IHC,IF	Nat Neurosci; Synaptic N6-methyladenosine (m6A) epitranscriptome reveals functional partitioning of localized transcripts.; Authors - Daria Merkurjev
human	WB,IP	Mol Cell; Stabilization of ERK-Phosphorylated METTL3 by USP5 Increases m 6 A Methylation; Authors - Hui-Lung Sun
human	WB	Mol Cell; Altered m6A Modification of Specific Cellular Transcripts Affects Flaviviridae Infection.; Authors - Nandan S Gokhale

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nikolett (Verified Customer) (09-05-2025)

This is antibody is working well do detect WTAP without any undesired band. I used it as 1:1000 dilution, incubated overnight at 4°C.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human Lung Cancer Cell Lines (Ludlu-1, H1299, A549)

FH

Daniel (Verified Customer) (06-25-2019)

RCC4 grown in normoxic (left lane) and hypoxic (right lane) conditions.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: RCC4 human cells

WTAP Antibody Western Blot, validation (1:2000 dilution) in RCC4 human cells (Cat no:60188-1-Ig)