• Featured Product
  • KD/KO Validated

WT1 Polyclonal antibody

WT1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12609-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IF/ICC, FC (Intra), IP, chIP, ELISA

Wilms tumor 1, Wilms tumor protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, A431 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue, MOLT-4 cells
Positive IP detected inK-562 cells
Positive IF/ICC detected inK-562 cells
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12609-1-AP targets WT1 in WB, IF/ICC, FC (Intra), IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3337

Product name: Recombinant human WT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-302 aa of BC032861

Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL

Predict reactive species
Full Name Wilms tumor 1
Calculated Molecular Weight 449 aa, 49 kDa, 57 kDa
Observed Molecular Weight 52-55 kDa
GenBank Accession NumberBC032861
Gene Symbol WT1
Gene ID (NCBI) 7490
RRIDAB_2216225
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19544
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. WT1 exists some isoforms with the range of molecular weight is 33-50 kDa.

Protocols

Product Specific Protocols
WB protocol for WT1 antibody 12609-1-APDownload protocol
IF protocol for WT1 antibody 12609-1-APDownload protocol
IP protocol for WT1 antibody 12609-1-APDownload protocol
FC protocol for WT1 antibody 12609-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

The IMiD target CRBN determines HSP90 activity toward transmembrane proteins essential in multiple myeloma.

Authors - Michael Heider
mouseWB,IF

Mol Psychiatry

Brain-specific Wt1 deletion leads to depressive-like behaviors in mice via the recruitment of Tet2 to modulate Epo expression.

Authors - Fen Ji
  • KO Validated
humanWB

Dev Cell

Mitochondrial CCN1 drives ferroptosis via fatty acid β-oxidation

Authors - Wanxin Guo
mousechIP

EMBO Mol Med

Inhibition of Aurora Kinase B attenuates fibroblast activation and pulmonary fibrosis.

Authors - Rajesh K Kasam
humanWB,IHC

Oncogene

YAP induces high-grade serous carcinoma in fallopian tube secretory epithelial cells.

Authors - G Hua
mouseWB

Oncogene

USP13 promotes development and metastasis of high-grade serous ovarian carcinoma in a novel mouse model.

Authors - Juntae Kwon

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sandrine (Verified Customer) (12-17-2021)

clean signal for IP and western blot. Good relative enrichment for ChIP assays.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation, ChIP
  • Cell Tissue Type: kidney tissue/Podocytes
FH

K (Verified Customer) (12-20-2020)

This Ab worked well for IHC (1:200) but I could't get satisfactory results for western blotting.

  • Applications: Western Blot, Immunohistochemistry
  • Cell Tissue Type: mouse liver tissues. rat liver and human liver cells
Loading...