• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated WNT2 Polyclonal antibody

WNT2 Polyclonal Antibody for IF/ICC
Cat No. CL488-27214

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Int 1 like protein 1, Int 1 related protein, INT1L1, Int-1-like protein 1, Int-1-related protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27214 targets WNT2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25845

Product name: Recombinant human WNT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 231-270 aa of BC029854

Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY

Predict reactive species
Full Name wingless-type MMTV integration site family member 2
Calculated Molecular Weight 40 kDa
Observed Molecular Weight40 kDa, 34 kDa
GenBank Accession NumberBC029854
Gene Symbol WNT2
Gene ID (NCBI) 7472
RRIDAB_3672808
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09544
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 WNT2 antibody CL488-27214Download protocol
IF protocol for CL Plus 488 WNT2 antibody CL488-27214Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...