WIBG Polyclonal antibody, PBS Only

• 

  IHC staining of mouse colon using 14658-1-AP (same clone as 14658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 14658-1-AP (WIBG antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 14658-1-AP (same clone as 14658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using WIBG antibody (14658-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 14658-1-PBS in a different storage buffer formulation.

WIBG Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 14658-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14658-1-PBS targets WIBG in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6276

  Product name: Recombinant human WIBG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-204 aa of BC006135

  Sequence: MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

• Full Name: within bgcn homolog (Drosophila)
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC006135
• Gene Symbol: WIBG
• Gene ID (NCBI): 84305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRP8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein WIBG homolog, also known as PYM1 (Partner of Y14 and mago), is a cytoplasmic RNA-binding protein, that can interact with the ribosome and EJC, may act as an EJC destabilizing factor, preventing EJC accumulation at positions away from exon-exon junctions (non-canonical position).