WFDC1 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 13204-1-AP (same clone as 13204-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13204-1-AP (WFDC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13204-1-AP (same clone as 13204-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13204-1-AP (WFDC1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13204-1-AP (same clone as 13204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13204-1-AP (WFDC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13204-1-AP (same clone as 13204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13204-1-AP (WFDC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 13204-1-AP (same clone as 13204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 13204-1-AP (WFDC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 13204-1-AP (same clone as 13204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 13204-1-AP (WFDC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13204-1-PBS in a different storage buffer formulation.

WFDC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13204-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13204-1-PBS targets WFDC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3960

  Product name: Recombinant human WFDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-220 aa of BC029159

  Sequence: ALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ

• Full Name: WAP four-disulfide core domain 1
• Calculated Molecular Weight: 220 aa, 24 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC029159
• Gene Symbol: WFDC1
• Gene ID (NCBI): 58189
• RRID: AB_2215895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC57
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.