VWF Recombinant monoclonal antibody

VWF Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 83854-2-RR
Clone No.240867D10

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF-P, ELISA

VWF, VWFpp, VWD, von Willebrand antigen II, F8VWF, 240867D10

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, rat spleen tissue
Positive IHC detected inhuman tonsillitis tissue, human ovary cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83854-2-RR targets VWF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25578

Product name: Recombinant human vwf protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 754-854 aa of

Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

Predict reactive species
Full Name von Willebrand factor
Observed Molecular Weight309-320 kDa
Gene Symbol VWF
Gene ID (NCBI) 7450
RRIDAB_3671439
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via 27186a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155).

Protocols

Product Specific Protocols
WB protocol for VWF antibody 83854-2-RRDownload protocol
IHC protocol for VWF antibody 83854-2-RRDownload protocol
IF protocol for VWF antibody 83854-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...