UBE2D1/2/3/4 Polyclonal antibody, PBS Only

• 

  WB analysis using 11373-1-AP (same clone as 11373-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11373-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 11373-1-AP (same clone as 11373-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:500. . This data was developed using the same antibody clone with 11373-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11373-1-AP (same clone as 11373-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11373-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 11373-1-AP (same clone as 11373-1-PBS)

  IP result of anti-UBE2D1/2/3/4 (IP:11373-1-AP, 4ug; Detection:11373-1-AP 1:300) with Jurkat cells lysate 2600 ug. This data was developed using the same antibody clone with 11373-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11373-1-AP (same clone as 11373-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11373-1-PBS in a different storage buffer formulation.

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11373-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11373-1-PBS targets UBE2D1/2/3/4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1932

  Product name: Recombinant human UBE2D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC015997

  Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

• Full Name: ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC015997
• Gene Symbol: UBE2D1
• Gene ID (NCBI): 7321
• RRID: AB_2210129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51668
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.