UBE2D1/2/3/4 Polyclonal antibody

• 

  WB analysis using 11373-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 11373-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:500. .

• 

  WB analysis of HeLa using 11373-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 11373-1-AP

  IP result of anti-UBE2D1/2/3/4 (IP:11373-1-AP, 4ug; Detection:11373-1-AP 1:300) with Jurkat cells lysate 2600 ug.

• 

  IHC staining of human prostate cancer using 11373-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11373-1-AP (UBE2D1-Specific antibody) at dilution of 1:50 (under 10x lens).

UBE2D1/2/3/4 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11373-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

E2(17)KB1, SFT, Stimulator of Fe transport, UBC4/5, UBC4/5 homolog, UBC5A, UBCH5, UBCH5A, UBE2D, UBE2D1, UBE2D1/2/3/4, UBE2D2, UBE2D3, UBE2D4, Ubiquitin carrier protein D1, Ubiquitin protein ligase D1

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, Jurkat cells, mpuse heart tissue, mouse thymus tissue
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11373-1-AP targets UBE2D1/2/3/4 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1932

  Product name: Recombinant human UBE2D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC015997

  Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

• Full Name: ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC015997
• Gene Symbol: UBE2D1
• Gene ID (NCBI): 7321
• RRID: AB_2210129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51668
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	WB	FASEB J; ATP7A Maintains Bactericidal Function of Neutrophils and Macrophages via Regulating the Formation and Activation of Phagolysosomes; Authors - YuanYuan Jing