CoraLite® Plus 488-conjugated Titin Polyclonal antibody

Titin Polyclonal Antibody for IF/ICC
Cat No. CL488-27867

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IF/ICC

CMD1G, CMH9, CMPD4, CONNECTIN, DKFZp451N061, EOMFC, FLJ26020, FLJ26409, FLJ32040, FLJ34413, FLJ39564, FLJ43066, HMERF, LGMD2J, titin, TMD, TTN

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27867 targets Titin in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27496

Product name: Recombinant human TTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33738-33969 aa of NM_001256850

Sequence: MFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIK

Predict reactive species
Full Name titin
Calculated Molecular Weight 3816 kDa
GenBank Accession NumberNM_001256850
Gene Symbol Titin
Gene ID (NCBI) 7273
RRIDAB_3672819
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WZ42
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Titin antibody CL488-27867Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...