TNF-alpha Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TNF-alpha Polyclonal antibody (17590-1-AP)

TNF-alpha Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17590-1-AP

Publications(1233)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (6)

Applications

WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay

Synonyms

TNF, TNF alpha, TNF-a, C-domain 1, C-domain 2

• 

  WB analysis using 17590-1-AP

  Untreated THP-1 and THP-1 (treated with 80nM PMA overnight, replaced the culture medium with 100 ng/ml LPS for 6 hours with addition of 300ng/ml Brefeldin A for the last 3 hours) cells were subjected to SDS PAGE followed by western blot with 17590-1-AP (TNF-alpha antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17590-1-AP

  Untreated THP-1 and THP-1 (treated with 80nM PMA overnight, replaced the culture medium with 100 ng/ml LPS for 6 hours with addition of 300ng/ml Brefeldin A for the last 3 hours) cells were subjected to SDS PAGE followed by western blot with 17590-1-AP (TNF-alpha antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 17590-1-AP

  LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 17590-1-AP (TNF alpha antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 17590-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated THP-1 cells using TNF-alpha antibody (17590-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells, LPS treated RAW 264.7 cells
• Positive IF/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17590-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, rabbit, bovine, sheep, fish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11433

  Product name: Recombinant human TNF-a protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC028148

  Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

• Full Name: tumor necrosis factor (TNF superfamily, member 2)
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC028148
• Gene Symbol: TNF-alpha
• Gene ID (NCBI): 7124
• ENSEMBL Gene ID: ENSG00000232810
• RRID: AB_2271853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01375
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exploration (Beijing); Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury; Authors - Jing Chang
mouse	WB	Exploration (Beijing); Microglial targeted therapy relieves cognitive impairment caused by Cntnap4 deficiency; Authors - Wenlong Zhang
mouse,human	WB,IF	Adv Mater; Membrane Fusion-Mediated Loading of Therapeutic siRNA into Exosome for Tissue-Specific Application; Authors - Miao Xie
rat,mouse	WB	Adv Mater; Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection.; Authors - Jingtao Liu
mouse	WB	Adv Mater; Unlocking an Efficient SOD-to-CAT Catalytic Relay in a MOF Nanozyme via Dopamine-Driven Interfacial Nanoreconstruction for Osteoarthritis Therapy.; Authors - Zhiqiang Li
		Bioact Mater; Polymer-Zn(II) sunscreens for protection against harmful blue ray.; Authors - Rui Yuan

Reviews

4.6 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

YINGJIAN (Verified Customer) (11-15-2025)

The antibody produced clear signals with negligible background and high target specificity.

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: WB: 1:2000 IHC (paraffin)：1：500
• Cell Tissue Type: liver

Margarita (Verified Customer) (11-22-2023)

Prostate Cancer cell line, overnight incubation, Mouse

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: TRAMPC C2

TNF-alpha Antibody Immunofluorescence validation (1:100 dilution) in TRAMPC C2 (Cat no:17590-1-AP)

Isha (Verified Customer) (09-20-2021)

signal was very good. My sample was renal tissue lysate after ischemia reperfusion

• Applications: Western Blot
• Primary Antibody Dilution: 1:800
• Cell Tissue Type: Kidney