Recombinant human TNF-a protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag11433
Synonyms
TNF, TNF alpha, TNF-a, C-domain 1, C-domain 2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
(1-233 aa encoded by BC028148) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
