TMEM173/STING Recombinant monoclonal antibody

• 

  WB analysis using 80165-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80165-1-RR (TMEM173/STING antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 80165-1-RR

  IP result of anti-TMEM173/STING (IP: 80165-1-RR, 4ug; Detection: 80165-1-RR 1:8000) with HeLa cells lysate 1800 ug.

• 

  IHC staining of human tonsillitis using 80165-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 80165-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 80165-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 80165-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 80165-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 80165-1-RR

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse cerebellum using 80165-1-RR

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse cerebellum tissue using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of THP-1 using 80165-1-RR

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  Affinity and Kinetic Characterization of 80165-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80165-1-RR against Human TMEM173/STING were performed. The affinity constant is 0.776 nM.

TMEM173/STING Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA

Cat No. 80165-1-RR

Clone No.7K7

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA

Synonyms

STING, 7K7, Endoplasmic reticulum interferon stimulator, ERIS, MITA

---

Tested Applications

• Positive WB detected in: HeLa cells, MOLT-4 cells, Jurkat cells, K-562 cells, THP-1 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human tonsillitis tissue, human colon tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue
• Positive IF-Fro detected in: mouse cerebellum tissue
• Positive IF/ICC detected in: THP-1 cells, human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

80165-1-RR targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13921

  Product name: Recombinant human TMEM173 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-379 aa of BC047779

  Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS

• Full Name: transmembrane protein 173
• Calculated Molecular Weight: 379 aa, 42 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC047779
• Gene Symbol: STING
• Gene ID (NCBI): 340061
• RRID: AB_2918870
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86WV6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int Immunopharmacol; Roflumilast attenuates neuroinflammation post retinal ischemia/reperfusion injury by regulating microglia phenotype via the Nrf2/STING/NF-κB pathway; Authors - Yuyan Guo
human,mouse	WB,IHC,IF	J Ethnopharmacol; Lycopodium japonicum Thunb. inhibits chondrocyte apoptosis, senescence and inflammation in osteoarthritis through STING/NF-κB signaling pathway; Authors - Jiawei Ma
human	IF	Mol Med; Pentagalloylglucose alleviates acetaminophen-induced acute liver injury by modulating inflammation via cGAS-STING pathway; Authors - Congyang Zheng
mouse,human	IF	J Immunother; Poly (ADP-Ribose) Polymerase 1 Induces Cyclic GMP-AMP Synthase-stimulator of Interferon Genes Pathway Dysregulation to Promote Immune Escape of Colorectal Cancer Cells; Authors - Jianhong Xia