• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated TINAGL1 Polyclonal antibody

TINAGL1 Polyclonal Antibody for IF-P
Cat No. CL647-12077

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

ARG1, GIS5, LCN7, LIECG3, OLRG 2, OLRG2, PSEC0088, TIN Ag related protein, TIN Ag RP, TINAGL, TINAGL1, TINAGRP, UNQ204/PRO230

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-12077 targets TINAGL1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2721

Product name: Recombinant human TINAGL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC009048

Sequence: MTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH

Predict reactive species
Full Name tubulointerstitial nephritis antigen-like 1
Calculated Molecular Weight 467 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC009048
Gene Symbol TINAGL1
Gene ID (NCBI) 64129
RRIDAB_2920220
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9GZM7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tinagl1 (tubulointer stitial nephritis antigen-like 1) is a matricellular protein most commonly associated with embryonic development, including the heart and adrenal glands. Low levels of Tinagl1 expression can be dire for craniofacial development and for female fertility. Tinagl1 can bind to EGFR and integrins on TNBC cells using the 4T1 murine model and that by interrupting normal tumor signaling in this way, cancer proliferation and metastasis pathways were downregulated.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 TINAGL1 antibody CL647-12077Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...