CoraLite® Plus 488-conjugated TDP-43 (C-terminal) Recombinant monoclonal antibody

TDP-43 (C-terminal) Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-81350
Clone No.5D17

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

IF/ICC, FC (Intra)

ALS10, TAR DNA binding protein, TAR DNA binding protein 43, TARDBP, TDP 43, TDP43, TDP-43

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81350 targets TDP-43 (C-terminal) in IF/ICC, FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4003

Product name: Recombinant human TDP-43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 261-414 aa of BC001487

Sequence: PKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

Predict reactive species
Full Name TAR DNA binding protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC001487
Gene Symbol TDP-43
Gene ID (NCBI) 23435
RRIDAB_3084500
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13148
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene. In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TDP-43 (C-terminal) antibody CL488-81350Download protocol
FC protocol for CL Plus 488 TDP-43 (C-terminal) antibody CL488-81350Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...