CoraLite® Plus 488-conjugated TDP-43 (C-terminal) Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-81350

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 TDP-43 (C-terminal) antibody (CL488-81350, Clone: 5D17 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-81350

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human TDP-43 (C-terminal) (CL488-81350, Clone:5D17) (red), or 0.8 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

TDP-43 (C-terminal) Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-81350

Clone No.5D17

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

IF/ICC, FC (Intra)

Synonyms

ALS10, TAR DNA binding protein, TAR DNA binding protein 43, TARDBP, TDP 43, TDP43, TDP-43

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81350 targets TDP-43 (C-terminal) in IF/ICC, FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4003

  Product name: Recombinant human TDP-43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-414 aa of BC001487

  Sequence: PKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

• Full Name: TAR DNA binding protein
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC001487
• Gene Symbol: TDP-43
• Gene ID (NCBI): 23435
• RRID: AB_3084500
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13148
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene. In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS).