Tested Applications
| Positive WB detected in | pig brain tissue, fetal human brain tissue, rat brain tissue, Y79 cells, rabbit brain tissue, mouse brain tissue |
| Positive IHC detected in | rat brain tissue, human brain tissue, mouse cerebellum tissue, rat cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:40000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66437-1-Ig targets Syntaxin 1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10257 Product name: Recombinant human STX1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-263 aa of BC062298 Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK Predict reactive species |
| Full Name | syntaxin 1B |
| Calculated Molecular Weight | 288 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa, 55 kDa |
| GenBank Accession Number | BC062298 |
| Gene Symbol | STX1B |
| Gene ID (NCBI) | 112755 |
| RRID | AB_2881807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P61266 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| IHC protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| WB protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Syntaxin 1B Monoclonal antibody (2D3B5), catalog number 66437-1-Ig, has 15 total citations. These appear in journals including Nature, Nature Neuroscience, Nature Communications, Journal of Physiology, Journal of Neuroinflammation, Brain Communications, Clinical Science, Neurochemistry International, Frontiers in Physiology, Neurotoxicology, STAR Protocols, Aging, and bioRxiv. Research fields encompass synaptic vesicle dynamics, SNARE-mediated exocytosis, Alzheimer's disease, neuroinflammation, tauopathy, pancreatic β-cell function, and opioid-induced constipation.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Munc18 modulates syntaxin phase separation to promote exocytosis.
| ||
Nat Commun Munc18 and Munc13 serve as a functional template to orchestrate neuronal SNARE complex assembly. | ||
Nat Commun Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice.
| ||
J Neuroinflammation Transient neuroinflammation following surgery contributes to long-lasting cognitive decline in elderly rats via dysfunction of synaptic NMDA receptor. | ||
Clin Sci (Lond) Chronic hepatitis C virus infection impairs insulin secretion by regulation of p38δ MAPK-dependent exocytosis in pancreatic β-cells. |
