SREBF1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 82684-3-RR (same clone as 82684-3-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 82684-3-RR (SREBF1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82684-3-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 82684-3-RR (same clone as 82684-3-PBS)

  WB result of SREBF1 antibody (82684-3-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SREBF1 transfected MCF-7 cells. This data was developed using the same antibody clone with 82684-3-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82684-3-RR (same clone as 82684-3-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug SREBF1 Recombinant antibody (82684-3-RR, Clone:1P4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82684-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82684-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82684-3-RR against Human SREBF1 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

SREBF1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 82684-3-PBS

Clone No.1P4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

1P4, bHLHd1, Class D basic helix-loop-helix protein 1, Processed sterol regulatory element-binding protein 1, SREBF 1

---

Product Information

82684-3-PBS targets SREBF1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5219

  Product name: Recombinant human SREBF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC063281

  Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK

• Full Name: sterol regulatory element binding transcription factor 1
• Calculated Molecular Weight: 1177 aa, 125 kDa
• Observed Molecular Weight: 68 kDa, 125 kDa
• GenBank Accession Number: BC063281
• Gene Symbol: SREBF1
• Gene ID (NCBI): 6720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267].