CoraLite® Plus 488-conjugated SPHK2 Polyclonal antibody

• 

  FC experiment of HeLa using CL488-17096

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human SPHK2 (CL488-17096) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

SPHK2 Polyclonal Antibody for FC (Intra)

Cat No. CL488-17096

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

EC:2.7.1.91, SK 2, SK-2, Sphingosine kinase 2, SPK 2

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17096 targets SPHK2 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10569

  Product name: Recombinant human SPHK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 266-618 aa of BC010671

  Sequence: LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

• Full Name: sphingosine kinase 2
• Calculated Molecular Weight: 618 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC010671
• Gene Symbol: SPHK2
• Gene ID (NCBI): 56848
• RRID: AB_3083997
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRA0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990).