SNX27 Monoclonal antibody

• 

  WB analysis using 68386-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68386-1-Ig (SNX27 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IF Staining of HeLa using 68386-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SNX27 antibody (68386-1-Ig, Clone: 2C4G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HEK-293 using 68386-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SNX27 antibody (68386-1-Ig, Clone: 2C4G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

SNX27 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68386-1-Ig

Clone No.2C4G5

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Sorting nexin-27, My014, KIAA0488, 2C4G5

---

Tested Applications

• Positive WB detected in: U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68386-1-Ig targets SNX27 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9447

  Product name: Recombinant human SNX27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-528 aa of BC012184

  Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY

• Full Name: sorting nexin family member 27
• Calculated Molecular Weight: 61 kDa, 60 kDa, 52 kDa, 28 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC012184
• Gene Symbol: SNX27
• Gene ID (NCBI): 81609
• RRID: AB_3085104
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96L92
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	J Virol; Fish Snx27 promotes viral products by modulating the innate immune response and exosomal machinery; Authors - Yepin Yu