SNX27 Monoclonal antibody, PBS Only

SNX27 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68386-1-PBS
Clone No.2C4G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Sorting nexin-27, My014, KIAA0488, 2C4G5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68386-1-PBS targets SNX27 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9447

Product name: Recombinant human SNX27 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 310-528 aa of BC012184

Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY

Predict reactive species
Full Name sorting nexin family member 27
Calculated Molecular Weight 61 kDa, 60 kDa, 52 kDa, 28 kDa
Observed Molecular Weight61 kDa
GenBank Accession NumberBC012184
Gene Symbol SNX27
Gene ID (NCBI) 81609
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96L92
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).

Loading...
||
New chat Able
正在加载,请稍候...