CoraLite® Plus 488-conjugated SMN (Human,Mouse,Rat) Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-60154

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 SMN (Human,Mouse,Rat) antibody (CL488-60154, Clone: 3C10B5 ) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL488-60154

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 488-conjugated SMN (Human,Mouse,Rat) Monoclonal antibody (CL488-60154, Clone:3C10B5)(red), or 0.4 ug CoraLite® Plus 488 Mouse IgG2b isotype control (11B8C4) (CL488-66360-3, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

SMN (Human,Mouse,Rat) Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-60154

Clone No.3C10B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

SMN, 3C10B5, C BCD541, Component of gems 1, Gemin 1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60154 targets SMN (Human,Mouse,Rat) in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14333

  Product name: Recombinant human SMN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-282 aa of BC000908

  Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

• Full Name: survival of motor neuron 2, centromeric
• Calculated Molecular Weight: 282 aa, 30 kDa
• GenBank Accession Number: BC000908
• Gene Symbol: SMN
• Gene ID (NCBI): 6607
• RRID: AB_2919231
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16637
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-2-Ig can recognize human,mouse and rat SMN gene.