SLC25A46 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83360-2-RR (same clone as 83360-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83360-2-RR (SLC25A46 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83360-2-PBS in a different storage buffer formulation.

• 

  FC experiment of Caco-2 using 83360-2-RR (same clone as 83360-2-PBS)

  1x10^6 Caco-2 cells were intracellularly stained with 0.25 ug SLC25A46 Recombinant antibody (83360-2-RR, Clone:240114G3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83360-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83360-2-RR (same clone as 83360-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug SLC25A46 Recombinant antibody (83360-2-RR, Clone:240114G3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83360-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00369-1

  Cytometric bead array standard curve of MP00369-1, SLC25A46 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83360-2-PBS. Detection antibody: 83360-3-PBS. Standard: Ag27293. Range: 0.625-80ng/mL.

• 

  Affinity and Kinetic Characterization of 83360-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83360-2-RR against Human SLC25A46 were performed. The affinity constant is 0.879 nM.

SLC25A46 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83360-2-PBS

Clone No.240114G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

240114G3, Mitochondrial outer membrane protein SLC25A46, TB1

---

Product Information

83360-2-PBS targets SLC25A46 as part of a matched antibody pair:

MP00369-1: 83360-2-PBS capture and 83360-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27293

  Product name: Recombinant human SLC25A46 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-382 aa of BC017169

  Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV

• Full Name: solute carrier family 25, member 46
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017169
• Gene Symbol: SLC25A46
• Gene ID (NCBI): 91137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96AG3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively.