SECTM1 Monoclonal antibody, PBS Only

• 

  WB analysis using 60281-1-Ig (same clone as 60281-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60281-1-Ig (SECTM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 60281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60281-1-Ig (same clone as 60281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60281-1-Ig (same clone as 60281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60281-1-Ig (same clone as 60281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60281-1-PBS in a different storage buffer formulation.

SECTM1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60281-1-PBS

Clone No.1C11B4

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

K12, Protein K 12, secreted and transmembrane 1, SECTM1

---

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

60281-1-PBS targets SECTM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14645

  Product name: Recombinant human SECTM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-248 aa of BC017716

  Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

• Full Name: secreted and transmembrane 1
• Calculated Molecular Weight: 248 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC017716
• Gene Symbol: SECTM1
• Gene ID (NCBI): 6398
• RRID: AB_2881399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: Q8WVN6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1.