CoraLite® Plus 647-conjugated SEC13 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL647-85110-4

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 647 SEC13 antibody (CL647-85110-4, Clone: 242775C3 ) at dilution of 1:400.

SEC13 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL647-85110-4

Clone No.242775C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

242775C3, D3S1231E, GATOR2 complex protein SEC13, Protein SEC13 homolog, SEC13A

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-85110-4 targets SEC13 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7610

  Product name: Recombinant human SEC13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-325 aa of BC002634

  Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

• Full Name: SEC13 homolog (S. cerevisiae)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC002634
• Gene Symbol: SEC13
• Gene ID (NCBI): 6396
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55735
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SEC13 is a component of the nuclear pore complex (NPC) and the COPII coat. It is required for esicle biogenesis from endoplasmic reticulum during the transport of proteins. Shuttling of SEC13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments. (PMID: 14517296; 16407955)