Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated S100P Polyclonal antibody

S100P Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-11803

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P, FC (Intra)

Migration-inducing gene 9 protein, Protein S100 P, Protein S100-E, Protein S100-P, S100 calcium binding protein P

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman breast cancer tissue
Positive FC (Intra) detected inSK-MEL-28 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11803 targets S100P in IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2379

Product name: Recombinant human S100P protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC006819

Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Predict reactive species
Full Name S100 calcium binding protein P
Calculated Molecular Weight 95 aa, 11 kDa
GenBank Accession NumberBC006819
Gene Symbol S100P
Gene ID (NCBI) 6286
RRIDAB_2919041
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25815
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 S100P antibody CL488-11803Download protocol
IF protocol for CL Plus 488 S100P antibody CL488-11803Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...