S100P Polyclonal antibody

S100P Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11803-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Migration-inducing gene 9 protein, Protein S100 P, Protein S100-E, Protein S100-P, S100 calcium binding protein P

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HuH-7 cells
Positive IHC detected inhuman pancreas cancer tissue, human bowen disease tissue, human colon cancer tissue, human urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11803-1-AP targets S100P in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2379

Product name: Recombinant human S100P protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC006819

Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Predict reactive species
Full Name S100 calcium binding protein P
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC006819
Gene Symbol S100P
Gene ID (NCBI) 6286
RRIDAB_2184577
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25815
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.

Protocols

Product Specific Protocols
IF protocol for S100P antibody 11803-1-APDownload protocol
IHC protocol for S100P antibody 11803-1-APDownload protocol
WB protocol for S100P antibody 11803-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IHC

Adv Sci (Weinh)

RBMS1 Coordinates with the m6 A Reader YTHDF1 to Promote NSCLC Metastasis through Stimulating S100P Translation

Authors - Yu Sun
humanIHC

Cancer Lett

Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes

Authors - Chengxuan Yu
humanWB,IHC

Am J Cancer Res

High expression of S100P is associated with unfavorable prognosis and tumor progression in patients with epithelial ovarian cancer.

Authors - Xiangyu Wang
humanIHC

Proteomics Clin Appl

Identification of distinctive protein expression patterns in colorectal adenoma.

Authors - F Lam Francis F
humanIHC

Diagn Pathol

Basal cell adenocarcinoma of the salivary gland: a morphological and immunohistochemical comparison with basal cell adenoma with and without capsular invasion.

Authors - Jung Min Jung MJ
humanWB

Exp Ther Med

Proof-of-concept study investigating the role of S100P-RAGE in nasopharyngeal carcinoma.

Authors - Chengyu Wang
Loading...
||
New chat Able
正在加载,请稍候...