Filter: AllIHCIF-P

IHC staining of human tonsillitis using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 66853-1-Ig (same clone as 66853-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66853-1-Ig (S100A8 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 66853-1-Ig (same clone as 66853-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using S100A8 antibody (66853-1-Ig, Clone: 1G11C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 66853-1-Ig (same clone as 66853-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using S100A8 antibody (66853-1-Ig, Clone: 1G11C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66853-1-PBS in a different storage buffer formulation.

S100A8 Monoclonal antibody, PBS Only

S100A8 Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 66853-1-PBS

Clone No.1G11C8

Review Product

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, IF-P, Indirect ELISA

Synonyms

CFAG, Calprotectin L1L subunit, Calgranulin-A, Calgranulin A, CAGA

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66853-1-PBS targets S100A8 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag8517 Product name: Recombinant human S100A8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species
Full Name	S100 calcium binding protein A8
Calculated Molecular Weight	93 aa, 11 kDa
GenBank Accession Number	BC005928
Gene Symbol	S100A8
Gene ID (NCBI)	6279
RRID	AB_2882193
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P05109
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.