Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human breast cancer tissue, human cervical cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 3 publications below |
| IF | See 5 publications below |
Product Information
66853-1-Ig targets S100A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8517 Product name: Recombinant human S100A8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species |
| Full Name | S100 calcium binding protein A8 |
| Calculated Molecular Weight | 93 aa, 11 kDa |
| GenBank Accession Number | BC005928 |
| Gene Symbol | S100A8 |
| Gene ID (NCBI) | 6279 |
| RRID | AB_2882193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05109 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A8 antibody 66853-1-Ig | Download protocol |
| IHC protocol for S100A8 antibody 66853-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome | ||
J Cell Biol Giant worm-shaped ESCRT scaffolds surround actin-independent integrin clusters | ||
Biochim Biophys Acta Mol Cell Res IL-17 promotes melanoma through TRAF2 as a scaffold protein recruiting PIAS2 and ELAVL1 to induce EPHA5 | ||
Front Immunol Glomerular Expression of S100A8 in Lupus Nephritis: An Integrated Bioinformatics Analysis. | ||
J Photochem Photobiol B Hemin protects UVB-induced skin damage through inhibiting keratinocytes apoptosis and reducing neutrophil infiltration | ||
Transl Oncol Single-cell RNA sequencing analysis revealed cellular and molecular immune profiles in lung squamous cell carcinoma |

















