• Featured Product
  • KD/KO Validated

ROR1 Monoclonal antibody, PBS Only (Detector)

ROR1 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66923-1-PBS
Clone No.1F5D8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

1F5D8, Inactive tyrosine-protein kinase transmembrane receptor ROR1, Neurotrophic tyrosine kinase, receptor-related 1, NTRKR1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66923-1-PBS targets ROR1 as part of a matched antibody pair:

MP51139-1: 66923-2-PBS capture and 66923-1-PBS detection (validated in Cytometric bead array)

MP51139-2: 66923-3-PBS capture and 66923-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14586

Product name: Recombinant human ROR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-364 aa of BC006374

Sequence: DECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRN

Predict reactive species
Full Name receptor tyrosine kinase-like orphan receptor 1
Calculated Molecular Weight 937 aa, 104 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC006374
Gene Symbol ROR1
Gene ID (NCBI) 4919
RRIDAB_2882250
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01973
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ROR1 is a member of the RTK family of orphan receptors related to muscle-specific kinase and Trk neurotrophin receptors (PMID: 18546292). ROR1 is primarily expressed by neural crest cells during embryogenesis. High expression of ROR1 is reported in many types of malignancies and is thought to be involved in tumor growth, apoptosis, and epithelial-mesenchymal transition (PMID: 26245996). The human ROR1 gene encodes a 937 amino acid protein with an Ig-like domain, a cysteine-rich domain, a kringle domain, a tyrosine kinase domain, and a proline-rich domain. The calculated molecular weight of ROR1 is 104 kDa, but ROR1 has multiple N-glycosylation sites that generate post-translationally modified ROR1 at 130 kDa (PMID: 24752542).

Loading...
||
New chat

Able

正在加载,请稍候...